Words Containing: Y,K
(In Any Order)
There are 2,534 words,
1,434 phrases and
4 abbr's with
Y,K in.
Best Scoring Words With: Y,K
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | skyjack | 7 | 27 | verbv | |||
2 | kolkozy | 7 | 27 | nounn | |||
3 | kolhozy | 7 | 26 | nounn | |||
4 | zinkify | 7 | 26 | ||||
5 | squawky | 7 | 26 | adjectiveadj | |||
6 | quickly | 7 | 25 | adverbadv | |||
7 | jaywalk | 7 | 24 | verb, adverbv, adv | |||
8 | quacky | 6 | 24 | adjectiveadj | |||
9 | zincky | 6 | 24 | adjectiveadj | |||
10 | muzaky | 6 | 24 | adjectiveadj | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
ky9Words (315)
monkey15likely13turkey13mickey17skinny13donkey14hockey18tricky15whisky19kidney14kindly14yakuza22freaky16sticky15yankeespooky15cheeky18weekly16bakery15stinky13sneaky13kersey13jockey22cranky15chucky20chunky18yorker13keynesquirky22kinseyskippy17towkay16sickly15hickey18frisky16
...View all with 6 letters...
Phrases (6)
by lucktab keynut keyhex keykey fobkey outWords (378)
quickly25frankly17whiskey20luckily16kennedyunlucky16payback20squeaky23mockery18prickly18starkeybarkleysketchy19shylock19cockney18krypton16wrinkly17sparkly16skyline14keyhole17yakking19parkway19hickory19cookery16trotskyweekday18rickety16walkway20keynote14killjoy21panicky18hackney19blankly16rookery14finicky19
...View all with 7 letters...
Phrases (38)
egg yolkpay backeye maskbuy backday bookde bakeydry kilndry milkhome keykey lime
...View all with 7 letters...
Words (416)
brooklynbackyard20unlikely15kentuckykeyboard18paycheck24berkeleyyearbook17junkyard23haystack20daybreak18skylight19yokohamaplayback21mckinleytrickery17playbook19weekdays19joystick24keystone15malarkey17kennellyladylike16jokingly23takeaway18yarmulke17workaday19crockery19bodywork21sukiyaki19unkindly16valkyrie18wickedly21copybook21teriyaki15
...View all with 8 letters...
Phrases (51)
minor keybaby talklock awaythank youeye blinkblack flyken keseymilk wheyeasy markplay back
...View all with 8 letters...
Words (376)
speakeasy18yorkshirepiggyback24knowingly20reykjavikawkwardly23skydiving21buttinsky18storybook18poppycock26skyrocket22mockingly21drunkenly17breakaway21tarkovskyunluckily18kimberleykeynesianmonkeying19wyszynskiyardstick19jaywalker26playmaker20jockeying26doohickey22cockamamy24thackerayhackneyed22gunnysack19keystroke20cyberpunk22stockyard19kandinskyskilfully19haymaking22
...View all with 9 letters...
Phrases (95)
lake nyasachurch keylike crazyevery weekgin rickeydry socketjockey capturkey leggunny sackturkey red
...View all with 9 letters...
Words (306)
bankruptcy23remarkably21thankfully23blackberry23mistakenly19skyscraper21bricklayer21recklessly19dostoevskyshockingly23stravinskyskillfully20paddywhack29moneymaker21freakishly23strikingly18rockabilly21skywriting21eukaryotic19pernickety21lawyerlike20spankingly20unshakably22likability19unladylike18pickaninny21donnybrook20prayerbookalkalinity17dyskinesia18trotskyiteankylosaur17merrymaker21lukewarmly22donkeywork25
...View all with 10 letters...
Phrases (130)
mary leakeybody of workmt. mckinleymaxim gorkygenus khayaprayer bookkuwait citytalk turkeyyard markerpastry cook
...View all with 10 letters...
Words (206)
unknowingly22hypermarket25tchaikovskydostoyevskyhuckleberry25honeysuckle23baryshnikovunspeakably22skulduggery21yellowknifepersnickety22hypokalemia25monkeyshine23hypokalemic27kinesiology19jabberwocky34keyboardist21bricklaying23sickeningly21moneymaking23merrymaking23kinyarwandaskeptically22workability23chokecherry28tiddlywinks23yastrzemskiyevtushenkounthinkably23talkatively21provokingly24thankworthy27outspokenly20hyperlinked24keystroking23
...View all with 11 letters...
Phrases (115)
louis leakeyhockey coachglossy snakelike royaltybilly the kidpolicy makermackerel skykeep an eye onalkyl halideclosely knit
...View all with 11 letters...
Words (123)
skullduggery22gobbledygook26unmistakably23stanislavskyhyperkalemiahyperkinetic26unthinkingly23ankylosaurus19checkerberry28holidaymaker25moneymakings24hyperkineses24hyperkinesia24heterokaryon22hyperlinking25honeysuckles24unskillfully22unblinkingly22monkeyshines24flickeringly25merrymakings24bricklayings24karyokinetic25hydrocracked28cytoskeleton21keyboardists22leukocytosis21cockeyedness24cytoskeletal21hyperkinesis24unremarkably23rekeyboarded23hypermarkets26cockneyfying30paddywacking29
...View all with 12 letters...
Phrases (132)
backspace keybody stockinglickety splithockey clinicshaking palsyhockey leaguejockey shortsrisky venturealkyl radicalginkgo family
...View all with 12 letters...
Words (60)
painstakingly23marketability24phytoplankton27psychokinetic29psychokinesis27holidaymakers26cytoskeletons22knowledgeably27rekeyboarding24unworkability25mountebankery24phytoplankter27hyperkinesias25heterokaryons23megakaryocyte28hydrocracking29gobbledygooks27tiddledywinks26psychokineses27unknowability25kindheartedly25kinematically24hydrocrackers28unshrinkingly24thankworthily29he-huckleberrybradykinesias23stickybeaking29blackberrying27fairnytickles25kitty-corneredclickety-clackclickety-clickblockheadedly29jawbreakingly33
...View all with 13 letters...
Phrases (113)
el iskandriyahbitter hickoryyakut languagemount mckinleyrobert m. yerkesjekyll and hydeturkey buzzardfactory workercocktail partynook and cranny
...View all with 13 letters...
Words (32)
unthinkability26hyperkeratotic28leukodystrophy30phytoplankters28ankylosauruses21karyotypically31breathtakingly27cockeyednesses26hyperkeratoses26hyperkeratosis26earthshakingly28heterokaryoses24heterokaryosis24heterokaryotic26cantankerously23megakaryocytic31acknowledgedly29megakaryocytes29phytoplanktons28hydrocrackings30hydrokinetical27leukocytosisesblackberry-lilyblackberryings28velvety-skinnedhuckleberrying29yekaterinoslavladylikenesses22rimsky-korsakovdiphenylketone27kinematography29brachypinakoid31Phrases (124)
anthony van dyckanthony vandykedimethyl ketonedrunken revelryveliky novgorodigor stravinskyemergency brakecapital of kenyablackberry bushskeletal system
...View all with 14 letters...
Words (22)
lackadaisically27heartbreakingly28kinesthetically27ankylostomiases24ankylostomiasis24phenylketonuric29cholecystokinin29telekinetically24phytoplanktonic31phenylketonuria27brokenheartedly28pyknodysostoses28pyknodysostosis28knowledgability29cockneyfication31kenogenetically25poverty-strickenacknowledgeably31lymphoblast-likehuckleberryings30diphenylketones28brachypinakoids32Phrases (101)
erlenmeyer flaskmask of pregnancyturkey drumstickkeep one's eyes offbuckthorn familycapital of turkeydocking facilityalfred korzybskinetwork topologysecurity blanket
...View all with 15 letters...
Words (10)
heterokontophytaleukodystrophieskinaestheticallyphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosisescholecystokininskrypterophaneronknowledgeabilityPhrases (86)
strictly speakinghypophyseal stalkalan lloyd hodgkincock-and-bull storyfyodor dostoevskifyodor dostoevskycapital of new yorkfriendly takeoverfrank lloyd wrightfamily gekkonidae
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (40)
nikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynsri lankan monetary unitisle royal national parksoren aabye kierkegaardpakistani monetary unitjohn fitzgerald kennedythomas kennerly wolfe jr.sir john cowdery kendrew
...View all with 21 letters...
Phrases (16)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykosubdivision ginkgophytinaaleksey maximovich peshkovfrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneylucy in the sky with diamonds
...View all with 24 letters...
Phrases (20)
igor fyodorovich stravinskyfrancis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskymelville louis kossuth deweypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkov
...View all with 25 letters...
Phrases (12)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventory
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay